PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn190471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 582aa    MW: 65998.5 Da    PI: 7.7254
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn190471genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32218272155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r+rWt++LH+rFve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Achn190471 218 KTRIRWTQDLHDRFVECVNHLGGPEKATPKAILKLMDTEGLTILHVKSHLQKYRI 272
                 68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.728215275IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-28217273IPR009057Homeodomain-like
SuperFamilySSF466891.51E-16217272IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24218273IPR006447Myb domain, plants
PfamPF002492.5E-8222271IPR001005SANT/Myb domain
PfamPF143792.9E-20297344IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PROSITE profilePS513759.942429463IPR002885Pentatricopeptide repeat
PfamPF015352.3E-5434459IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.0E-6434465IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.821541575IPR002885Pentatricopeptide repeat
PfamPF015351.2E-5544572IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.1E-5544575IPR002885Pentatricopeptide repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MATQKLAYDF GKQFTRNGVN GNWNSHFFGT QLQPENHMGI GIPSPNTGRE FGSLQKNSDQ  60
ASSSSTMLSR IGSPVSAFYA TEKYMGLPQF DFPSGIGNTD FQTPPYQSPG DRYCFEKTEE  120
SLGLKSHFCS NQNYGSDHEK SGQVPGNDFS EREKILQLKR KLLDDFDTSD RNQDICVNHS  180
LYNSQPEHMR QSRKPSAGGG ISVNSGNSVP SGAALASKTR IRWTQDLHDR FVECVNHLGG  240
PEKATPKAIL KLMDTEGLTI LHVKSHLQKY RIAKYIPESI EGKSEKKTNM NDTTSGMQIK  300
EALQLQLDVQ RRLHDQLEIQ RNLQLRIEEQ GRQLKQMFDQ QQNTNKDLFE MESPSLTLSD  360
YPLTSLDDLQ IPTDDGSGNT QFPSKIRYRA CGWTITLTLL FLRRLGCLKE VFVGEKVHGF  420
VVKSGVEFDC YVSNSLMDMY VRCNRFEDAI DVFRRMQRES SAKPNEATVF NHVDEAVALF  480
REMQFERFKP DKFTVDALLT GCAQLGALEQ GKWIHGPYGY VFKMCRMDKS LEIFRRLKEK  540
DTASWTSIIC GLAMNERSIK AVDLFSEMKR AGYERSLFNF G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ozs_A1e-1342357230172Alpha solenoid protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801945.13e-99PREDICTED: uncharacterized protein LOC104247585
RefseqXP_016456493.13e-99PREDICTED: uncharacterized protein LOC107780454
TrEMBLA0A061F4K85e-93A0A061F4K8_THECC; Myb-like HTH transcriptional regulator family protein, putative isoform 1
STRINGVIT_08s0007g06310.t019e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-61G2-like family protein